Participates in transcription elongation, termination and antitermination. In the absence of Rho, increases the rate of transcription elongation by the RNA polymerase (RNAP), probably by partially suppressing pausing. In the presence of Rho, modulates most Rho-dependent termination events by interacting with the RNAP to render the complex more susceptible to the termination activity of Rho. May be required to overcome a kinetic limitation of Rho to function at certain terminators. Also involved in ribosomal RNA transcriptional antitermination.

Belongs to the NusG family.

181 amino acids

MYKSYKKRWYVLQAFSGFEGRIAQSIREHVKLKKMEKLFGEVMVPSEEVIEIKAGQRKKSEYKFFPGYVLIQMIMNESSWHLVRSIPRVLGFIGGTPDRPLPITDQEVNTIINKLKQVGDKPRPKTLFEPGETVRVNDGPFSDFNGIVEEVDYEKNRLKVSVSIFGRSTPVELDFSQVKKN

20.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make nusG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here