Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors. Controls the subcellular localization of the homeodomain protein BLH1. Plays a role in the regulation of cell elongation by controlling the expression of GA20OX1, a gene that encodes a key enzyme in gibberellin biosynthesis. May play a role in double-stranded DNA repair through the DNA non-homologous end joining (NHEJ) pathway along with KU70 and KU80 protein complex. Possesses DNA-binding activity towards double-stranded and single-stranded DNA in vitro.

270 amino acids

MGNNYRFKLSELIPNAWFYKLRDMSKSKKKNLQSQPNSTTSKKKHHAVPTPTSTTPLSPRPPRRPSHSSKAPPSHPPRKSSGNRLRHRATVDSKSSTTSGDSTTTETGSFSPDFRSDQVLLPDESLTGSWHSPCSSKLSKTATFTPPPELELRPIITKTAATARKTAVNSPAGVRLRMRSPRISVSSSARRSGSSARRSRAVVKASVDPKRDFKESMEEMIAENKIRATKDLEELLACYLCLNSDEYHAIIINVFKQIWLDLNLPPPHSK

30 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make OFP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here