Transcription regulator complex subunit that is essential for cell cycle progression.

Belongs to the NC2 alpha/DRAP1 family.

199 amino acids

MGDPTNNNDSETKPNPATYWKSRFPVARIKKIMQADQDVGKVAQVTPVIMSKALELFMQSIIQESCKQTRLHQAKRVTVSHLKHAVQSVEQFDFLQDIVEKVPDAPPIKAERKTKRPRARRAANEGEHNESVPAKKVKKNTVKEEEIEKDDESATTETPVKEEPTGEETEADHEEKASVDHGNFSDKTTSEASSASGDE

22.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make bur6 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here