Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase (By similarity).

Belongs to the TFIIE beta subunit family.

285 amino acids

MSSLSDQLSSFKKKVANQPIYAKPQPRQPASPTPTAYLNSNDGHSSAASSPGSYSLKKKRSKTSLVYSQPADSGVGTHYLSQLHYAVEYLKERNEPKTAEEIASYLSTPLTPMLLNLLKKNNRIYYDERNETFTFKPLHNIRSGAGLLAYLDSQKTHVGMSIKELRDGWPNVTVELEELEKQGEVLLLRTRKDGVPKMVWRNDKSCDCHVDKEFQQVWHEIPIPPTLDLASELGKYGLKPTSVDPSTVKRAGHNQTPKQKKPKTRRGKITNTHLNILRDYSSMKP

32.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tfa2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here