Stabilizes TBP binding to an archaeal box-A promoter. Also responsible for recruiting RNA polymerase II to the pre-initiation complex (DNA-TBP-TFIIB).

Belongs to the TFIIB family.

300 amino acids

MSGKRVCPVCGSTEFIYDPSRGEIVCKVCGYVIEENVVDEGPEWRAFDPGQREKRARVGAPESILLHDKGLSTDIGIDRSLTGLMREKMYRLRKWQSRLRVSDAAERNLAFALSELDRLASNLSLPKHVEEEAARLYREAVRKGLIRGRSIEAVIAACVYAACRLLKVPRTLDEIADVSRVDKKEIGRSFRFIARHLNLTPKKLFVKPTDYVNKFADELGLSEKVRRRAIEILEEAYQRGLTSGKSPAGLVAAALYIASLMEGEKRTQREVAEVARVTEVTVRNRYKELVEKLNLKVPIA

33.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tfb1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here