Transcription factor that regulates the expression of genes in response to changes in temperature. In particular, binds to the promoter region of genes such as asp-17 in response to severe cold to warm temperature transitions to promote gene expression. Promotes stress-induced death, particularly in older animals, following cold shock followed by warming and this may have evolved as a form of kin survival under thermal stress conditions, favoring the survival of younger animals.

165 amino acids

MTTMTNSLISNSVSSVPESLFSSASIHRPVAINPAMLAQFSINLPVLPFESSASLGTSTTSSSRCSSTESSAAPGKIRRGRPQQEIADGQDAHSQKKRHRRLYARQYRAQMRQKVENVKSLHDEKEQLELEVKALRQAVSGLQQENAQKDFLISILQLNNQINHS

18.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make zip-10 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here