Transcription factor required for correct cell fate determination and differentiation in diverse neuronal cell lineages where it plays a role in specifying the fate of daughter cells during cell divisions (PubMed:7237544, PubMed:2257628). Involved in sensory neuron production and function (PubMed:1361171, PubMed:9735371, PubMed:10899123). Binds both alone and with mec-3 to the mec-3 promoter to initiate and maintain mec-3 expression which is required for sensory neuron differentiation (PubMed:1361171, PubMed:9735371). In addition, binds both alone and with mec-3 to the promoters of mec-4 and mec-7 which act to regulate sensory neuron function (PubMed:9735371, PubMed:10899123). Involved in determining the identity of the serotonergic NSM neurons and the cholinergic IL2 sensory and URA motor neurons (PubMed:24353061). Promotes expression of the cfi-1 transcription factor in the URA and IL2 neurons which in turn activates normal URA and IL2 gene expression (PubMed:24353061, PubMed:11959845). Regulates expression of a number of genes in NSM neurons including bas-1, cat-1, dop-3, mgl-3, nlp-13, scd-2 and ptps-1 (PubMed:24353061). In the IL2 neurons, required for expression of cho-1, gcy-19, klp-6, lag-2, unc-5 and unc-17 (PubMed:24353061). Promotes expression of pkd-2 in the male-specific CEM head neurons (PubMed:11959845). Required for dauer-specific branching of IL2Q neurons and nictation behavior (PubMed:23932402). Controls both the timing and direction of axon outgrowth in HSN neurons (PubMed:21656875). Plays a role in serotonin production by regulating expression of the tryptophan hydrolase tph-1 which catalyzes serotonin synthesis, in the AIM, NSM, HSN and RIH neurons (PubMed:12135927). Involved in regulation of lin-11 expression in the AIZ interneurons, the major interneurons of the olfactory pathway, and is required for odortaxis behavior (PubMed:12883006). Involved in neurite pruning between AIM neurons during larval development by regulating the expression of transcription factor mbr-1 (PubMed:16139210). Required for correct localization of unc-40 (PubMed:24353061).

Belongs to the POU transcription factor family. Class-4 subfamily.

467 amino acids

MEKAHRFRLPFCSFFPVPLLVSVLIFHHSAPFLIQLFFPSPLFNPLLRPSKISRGSENGACTSHSTLQRTRKIIQWELPKRGGDQDIGDPRPFRIHLSPPSFKVPLFSTDMQNTAPVPTTTTASKMQPFNNSLFGSFDDPILNARAAQVALADIDVKNVPQLTNPLMRPHDMFSYSNYFSGIHDTSAATNIYQGLPSSSEPFDASVVVPTSSDDQMTPLQQVMAMQQSYGAPPPFQYNMTHPFSTTSIASSNNLARYPIAPPTSDMDTDPRQLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSLSQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQKRDFRSQFRARSAAAVMGPRVMPVLNGNNSNNNLKQGQTTYNGLPGFFD

52.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make unc-86 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here