Protein expression services for dbaG | Transcription factor dbaG
Description
Transcription factor that coregulates the expression of the gene cluster that mediates the biosynthesis of the antibiotic 2,4- dihydroxy-3-methyl-6-(2-oxopropyl)benzaldehyde (DHMBA) and its derivatives (PubMed:23001671). Specifically positively regulates the expression of the FAD-dependent oxidoreductase dbaF (PubMed:23001671).
Species
Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Length
420 amino acids
Sequence
MPEDGPPKDIPDGLIEELALRAFFHDYCVVPVNTALSRGYLGGLEPMVHRLGLQSPVANACKAVAFASHGLKLSRPFLTKKGEILYHELLGSLARSIQNPALGAGPDIVVTAVLLGLYEMIMAGESNPGHHNAHAGGMAAILQIENSPLGLLQAARAGHPLVLNRMVQNNGMFISPSPGGGGQSLDTILVKLGSLWQKSETLLSNPQIPLFFDELYALREETTALNRDLILWQKAQSDNFKPTKVGYLSPSPYQLSPSAGFWPGQVDTYVDLYVAGVWNVSRVARCFLINLIVRLSNILDPTSDHRQYHNDVRELVGDIFASIPFHLTEDLGAFVAKRGANPEIANPGRPVGGLILLHPVYIASQLPVVPPDMQEYMRKCLAWIGKYMGIGQACLLAKAPRVEGQYFACGCMLVWAGLLI
Mass
45.6 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make dbaG using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here