May play a pivotal role in the transcriptional cascade that specifies primary neurons in embryos. Stabilizes the higher neural potential of selected progenitor cells that express neurog2/X-ngnr-1 by maintaining Delta-Notch signaling. Thus ensures the transition between neural competence and irreversible commitment to a neural fate. Also promotes neuronal differentiation by activating neurod1 expression, directly or indirectly.

Belongs to the COE family.

580 amino acids

MFGVQETFGTALRDKALGVGMDPVRSWVRNVGVVDAKVAAQSGVAVSRAHFEKQPPSNLRKSNFFHFVLALYDRQGQPIEIERTSFVDFVENEKEFSTEKTNNGTHYKLQLLYSNGVRTEQDLYVRLIDSVTKQPISYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTDPSLEYATPCIKAISPSEGWTTGGAMVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERMAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRNHNQIPALSSSPVHSGMMGINSYGGQLGVSISESQANNQGYIRNTSSISPRGYSSSSTPQQSNYSTPSNSMNGYSNVPMSNLGVPGSPGFINGSPTTSPYGIMPSSPPVGSSGSSSILPFSSSVFPSIKQKSAFAPVIRPQGSPSPACSSSNSNGFRAMTGLVVPPM

63.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ebf2-b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here