About Products Protein Database Contact

Protein expression services for Spib | Transcription factor Spi-B

Description
Sequence specific transcriptional activator which binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. Promotes development of plasmacytoid dendritic cells (pDCs), also known as type 2 DC precursors (pre-DC2) or natural interferon (IFN)-producing cells. These cells have the capacity to produce large amounts of interferon and block viral replication. Required for B-cell receptor (BCR) signaling, which is necessary for normal B-cell development and antigenic stimulation (By similarity).
Family
Belongs to the ETS family.
Species
Rattus norvegicus
Length
269 amino acids
Sequence
MLALEAAQLDGPHLSCLQYPEGVFYDLDSCKSFSYPDSDGGPDSTWGWTEAPPAPAIAAYEAFDPAATAAFAHTQAVQLCYGHGPSPSTYSPVGTLDPAPSLEASGPGLQVYPSEDFTSQTLGSLAYAPYPSPVLSEEEDILLDSPALEVSDSESDEALLAGSEGRGSEAGARKKLRLYQFLLELLLRGDMRECVWWVEPGAGVFQFSSKHKELLARRWGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAARRA
Mass
29.4 kDa
Simulated SDS-PAGE
Western blot of Spib recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Spib using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here