Zinc-finger transcription repressor factor (PubMed:15225875, PubMed:23319585). Plays a critical role in maintaining the identity of epithelial lineages by suppressing epithelial-to mesenchymal transition (EMT) mainly through the repression of ZEB1, an EMT inducer (PubMed:24735878, PubMed:24735879). Positively regulates neuronal differentiation (PubMed:16423343, PubMed:23319585). Suppresses cell cycling and terminal differentiation of keratinocytes by directly repressing MYC and NOTCH1 (By similarity). Important for the correct development of primordial germ cells in embryos (PubMed:28059165).

Belongs to the krueppel C2H2-type zinc-finger protein family.

274 amino acids

MPKVFLVKRRSPGVSVRSWDELPDDKRADTYIPVSLGCLLRDPPEDCRSDGGSSSGCSSSAGEPGGAESSSSPRAPEPETPELHDAQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHNCDLCGKSFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCEVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSDHPGSTFLKKTSKKLAALMQNKLTSPLQENSTLSEEEEKK

30.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ovol2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here