Acts as a transcriptional activator or repressor. Positively regulates the expression of alpha A crystallin genes during lens fiber cell differentiation. Binds to Maf recognition elements (MARE).

Belongs to the bZIP family. Maf subfamily.

359 amino acids

MASELAMSGSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLIAGGSLSSTPMSTPCSSVPPSPSFSAPSPGSGTDQKTHLEDYYWMTGYPQQLNPEALGFSPEDAVEALINSSHHPLPGAFDGYARGQQLAAAAGGSVPAEEMGSAAAVVSAVIAAAAAQGGAPHYHHHHHHPHHGGGGGGGGHPHGAAPGSAPPSSASSSAAGSGGGGGGGGGGAGGLHHPHHGGGGGGGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHVLESEKNQLLQQVEHLKQEISRLVRERDAYKEKYEKLVSNGFRENGSSSDNPSSPEFFM

37.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make MAF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here