Protein expression services for MYB87 | Transcription factor MYB87
Description
Transcription factor that functions as regulator of genes affecting cell wall organization and remodeling. Activates genes related to the primary cell wall and represses genes related to the secondary cell wall and expansins. Required for the regulation of longitudinal cell growth in stems, leaves, petioles, roots, flowers and siliques.
Species
Arabidopsis thaliana
Length
305 amino acids
Sequence
MGRAPCCDKMAVKKGPWSTEEDAVLKSYIEKHGTGNNWISLPQRIGIKRCGKSCRLRWLNYLRPNLKHGGFTDEEDYIICSLYITIGSRWSIIASQLPGRTDNDIKNYWNTRLKKKLLSKQGKAFHQQLNVKFERGTTSSSSSQNQIQIFHDENTKSNQTLYNQVVDPSMRAFAMEEQSMIKNQILEPFSWEPNKVLFDVDYDAAASSYHHHASPSLNSMSSTSSIGTNNSSLQMSHYTVNHNDHDQPDMFFMDGFENFQAELFDEIANNNTVENGFDGTEILINNNYLDHDISSFIDYPLYDNE
Mass
35 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make MYB87 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here