Protein expression services for MYB64 | Transcription factor MYB64
Description
Transcription factor required for female gametophyte fertility (PubMed:23057675, PubMed:24068955). Acts redundantly with MYB119 to initiate the FG5 transition during female gametophyte development. The FG5 transition represents the switch between free nuclear divisions and cellularization-differentiation in female gametophyte, and occurs during developmental stage FG5 (PubMed:24068955).
Species
Arabidopsis thaliana
Length
423 amino acids
Sequence
MEEQKIQEKSLAHGAAPPLTAVERFLNGQKNEALCFKKQERSIDRPIVKTTRAIEIRNENKENMMFGPRKEKNLAVIGEIVVKGAAKDYTCKDITKKQPYKNIIKGQWTADEDRKLIKLVMQHGERKWAVISEKLEGRAGKQCRERWHNHLRPDIKKDSWSEEEERLLVEAHTRIGNKWAEIAKLIQGRTENSIKNHWNATKRRQNSKRKHKRSKNADSNSDIDDLSPSAKRPRILEDYIKNIENNDKNNGENIMTTSGNNVLSTSNYDQFNSEDSTSSLLDDPYDEELVFLKNIFENHSLENINLSQGTEITQSSSSGFMIENPKPKPNLYNNTFGTHLGAMVTEPANSSHLASDIYLSDLLNGTASSSSSLTFLSSNNNEHAGENELLLPQANSTSERREMDLIEMLSGSTQGSNIWFPLF
Mass
48.1 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make MYB64 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here