Transcriptional repressor. Essential in the retina to govern glial versus neuronal differentiation. Promotes gliogenesis through the inhibition of neuronal differentiation by at least two distinct mechanisms; represses proneural gene transcription, and also physically interacts with proneural proteins, including neurod1.

191 amino acids

MAPNVALADSMHNYQPKPGKRNQEASELRKTLKPLMEKRRRARINESLNQLKTLILPLIGKDNSRYSKLEKADILEMTVRFLRDIPPVQAQNQADRYKEGYRACVERLSAILGKSHVLTGEASNRLLEYLQRSPELCSSDCNHPPKPQRPRIVLQVSPRTSQFGSPLQNQPSSHRPAPCPPQLNSSIWRPW

21.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hes2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here