Transcription factor required during cardiovascular development. Plays an important role in the transcriptional program(s) that underlies smooth muscle cell diversity. Binds to the functionally important CEF-1 nuclear protein binding site in the cardiac-specific slow/cardiac troponin C transcriptional enhancer (By similarity).

403 amino acids

MYQSLALAPSPGQTAYADSGAFLHTPGAGSPVFVPPARVPSMLPYLPACEPGPQAPAITAHPGWAQAAAADSSAFGSGSPHAPAAPPPGTTAFPFAHSSPGPGGGTGTRDNGAFQGAMLAREQYPAALGRPVSSSYPTAYPAYMSAEVAPSWTSGPLDGSVLHSLQGLPAGLPGRRAPFAAELLEEFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRAGLCCTNCHTTTTTLWRRNVDGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKNIAKTKGSSGSSGHTTASPQASVPDPEVSAATLKPEPSLASPSCPGPSVTSQGSAQVDDPLAPSHLEFKFEPEDFALPSAALGQQAGLGGALRQEAWCALALA

41.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GATA5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here