About Products Protein Database Contact

Protein expression services for tfe | Transcription factor E

Description
Transcription factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Facilitates transcription initiation by enhancing TATA-box recognition by TATA-box-binding protein (Tbp), and transcription factor B (Tfb) and RNA polymerase recruitment. Not absolutely required for transcription in vitro, but particularly important in cases where Tbp or Tfb function is not optimal. It dynamically alters the nucleic acid-binding properties of RNA polymerases by stabilizing the initiation complex and destabilizing elongation complexes. Seems to translocate with the RNA polymerase following initiation and acts by binding to the non template strand of the transcription bubble in elongation complexes.
Family
Belongs to the TFE family.
Species
Nanoarchaeum equitans (strain Kin4-M)
Length
139 amino acids
Sequence
MPTSKQIINKKQDEVSDIYGKEMIRVIRSLLKHKIIDTESLSKKTGYSINTVRRALYTLQKMGIVRYINKEDKTLWQLLETDYEKILDTLLEPYKKEEKAETGELLFICPKCGRKYTLDEAEMYEFRCPEDGTLLVANQ
Mass
16.3 kDa
Simulated SDS-PAGE
Western blot of tfe recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make tfe using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here