Description
Transcription factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Facilitates transcription initiation by enhancing TATA-box recognition by TATA-box-binding protein (Tbp), and transcription factor B (Tfb) and RNA polymerase recruitment. Not absolutely required for transcription in vitro, but particularly important in cases where Tbp or Tfb function is not optimal. It dynamically alters the nucleic acid-binding properties of RNA polymerases by stabilizing the initiation complex and destabilizing elongation complexes. Seems to translocate with the RNA polymerase following initiation and acts by binding to the non template strand of the transcription bubble in elongation complexes.
Family
Belongs to the TFE family.
Species
Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Sequence
MTDSNDPVVRGYLLQLIGEEGIEMIENMPEGEVTDEQIAEASGVMLNIVRRTLFIMNENNLAVCRRERDSSSGWLTYLWQLDLSDIESHLVKEKKRITKNLEIRYNFEVDSVFYTCPEGCVRFEFKEASKCEFMCPACGEDMMFEDNSVMVKKLRDRLDALEASS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service