Regulates the expression of chorion genes through binding to gene promoter elements identical to those recognized by the GATA family of transcription factors. Isoform 1 may act as a gonad-specific trans-activator while isoform 2 and isoform 3 may serve as ubiquitous transcriptional modulators.

508 amino acids

MDATMQTTKHEYQFEGAAECGYPPGRTGLSPAAQLPGAAAAHSLDMQPYSHLDDSLFKPPTPGSAPPTASTCAGVPSSAPRRRPRRLRPPAPLHYDDYAPPPPYSHDHHHHLEQGGGGNGAASRCTAVRLQQRRAILHQRSRPLRPAAALDRVRRVSELRQQRDTGGRIRRERAEGWGSPCRLSTRGSAAPSPAPAGARSAVAGRIFRVVNDIYAAMGIHNMFIDADLGGVITPGFGLGKVKGGRQAGVELTFMRTVELAEFFTEGRECVNCGAIHTPLWHRDGTGHYLCNACGLYNKMNGMNRPLKQPRRLMAAKRPGTMCTNCQTTATSLWRRNVQGETVCNACGLYFKLHNVNRPLTMKKDSIQTRKRKPKNSNIKADRSAKAVQRASPRASRWRAYWMRRRSPPRLGYYVQSAEGMKLEEPQHHVMYIGVPELGPDTRTRRTTTTPPCRSPAETSRPTPNIIIIISTFVVYICTCVIELPRSDRRRRRRRRSPPKYTFTRHDYI

56.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make GATA-B using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here