Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions.

Belongs to the AP-2 family.

423 amino acids

MLVHSYSSMERADGLSSSSPGGRLSQLNQAAYSSAPPLCHTPASDFQPPYFPPPYPQSSLSYSQSQDGGYPHLPEPYPSLNSLHQHQQAAWHSQRSRSEDAGLLSQPHRALSLDPRREYPGVPRLLTHGLGDGAAALGDGPLGMHAVHHGLDDIQGLEEASALGILDHSVIKKVPLPSKLNGSTISALSLSKEGLGLGGVSNPAEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLAPPECLNASLLGGVLRRAKSKNGGRCLRERLEKIGLNLPAGRRKAANVTLLTALVEGEAVHLARDFGYVCETEFPARATAEYLCRQTEPDQLPTRRSMLLATKEICKEFVDLMSQDRSPLGASRPTPCLEPGVQSSLTHFSLLTHGFGTPALCAALSAFQSYLLEALKLLDKGENGGKNHHDKELKHRK

45.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tfap2e using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here