Selectively binds to and inhibits the transcription of hydroxymethyluracil-(hmUra)-containing DNA, such as SP01 DNA, by RNA polymerase in vitro.

Belongs to the bacterial histone-like protein family.

99 amino acids

MNKTELIKAIAQDTELTQVSVSKMLASFEKITTETVAKGDKVQLTGFLNIKPVARQARKGFNPQTQEALEIAPSVGVSVKPGESLKKAAEGLKYEDFAK

10.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here