The spt4-spt5 complex mediates both activation and inhibition of transcription elongation, and plays a role in pre-mRNA processing. This complex seems to be important for the stability of the RNA polymerase II elongation machinery on the chromatin template but not for the inherent ability of this machinery to translocate down the gene (By similarity).

Belongs to the SPT4 family.

105 amino acids

MDKLNRTRSRACLICGIVLPHSVFANKGCPNDGVDDVETFTSPVFEGIMAMMSPTESWVARWQRIDTFTPGIYATRVQGVLNEDVVESLRRRGINYRPRNGTSWD

11.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make spt4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here