About Products Protein Database Contact

Protein expression services for greB | Transcription elongation factor GreB

Description
Necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by cleavage factors such as GreA or GreB allows the resumption of elongation from the new 3'terminus. GreB releases sequences of up to 9 nucleotides in length.
Family
Belongs to the GreA/GreB family. GreB subfamily.
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Length
161 amino acids
Sequence
MKTKLITRAGYNKLKQELDYLWKEQRPEITQKVSWAASLGDRSENADYTYNKRLLRQIDRRVRFLSKLLPELKIVDYSPQQEGKVFFGAWVEIENEAGEVKKFRIVGPEEIYGDAKDYISIDSPMARALLKKQVDEEFQVHTPTGIKEWFINSIEYEKGEL
Mass
18.9 kDa
Simulated SDS-PAGE
Western blot of greB recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make greB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here