Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus (By similarity).

Belongs to the TFS-II family.

319 amino acids

MQEIIKCREQLEKAIKDGEFDKALECLKNAKNFKITKDLLKSTDIGKSVGKLRAHKDIGISSQSKELIDKWKQDIEGTSATTTSSSSSSSSSTTSTTTTKTASPSESLKRKSISEDTSDRPTSKPLLQENKKISPPTTPKTSSPPIASLIAPITGANADLRNKTIQLFVEALTTDNDETMSPPEDIAVEIEAEMYDIYRGVSKEYKEKLRSFKFNLKKNDILRLSLLNRQISVAKFCSMDIYSMASDDLKEERKKLDKFNTEASMLGQNNEATTDQFQCGKCKQRKCTYTQLQTRSADEPPTTFVKCCVKGCGNRWRFC

35.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tcea1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here