DNA helicase which seems to act as a postreplicative transcription termination factor. Involved in ATP-dependent release of nascent RNA. Forms a stable complex with single-stranded DNA, and to a lesser extent RNA (By similarity).

Belongs to the helicase family. Poxviruses subfamily.

462 amino acids

MSYITVIDDKLYSSLRKLVGYSPLYLFNDKGDFVEVMKNSEFRFLIPSGYFSNSNVPLYGLTFSYGRNWMKDRQKIILPELYPIQRRVIEEIILQFSRKCKEKRPLYTTLHLACGFGKTVTASYLIGTHKKNAVVSVPNKLILKQWENSISSLKVSYYVSYEGVSKLLKVLTSKSFSILVVVDKHFSNKEFCELVYENYDVFILDEAHIYNLMNESIMTSFLCYYPPRICYFLTATPRQQNAVYCNSIINFIKFSPLQKILYVIRELYNEYTNPSIRAHVSQLQTTANKYHLYTEKALAEDIHRNKTIVDKIIETFKTNQGNRILVITKLRNHMIIIYNDLRKVLSDKVYLGDAQKKSTTDMIKELRTIDNFILVSTLHYAGTGLDIPNLDSLFICNTVMNSMQSEQVMGRICRDTGSSPTRSIYLFINTSIKEIKSLVGVFTQRFAQQATKLGFREVSQMA

53.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FPV183 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here