Description
Transaminase; part of the gene clusters that mediate the biosynthesis of AM-toxins, host-selective toxins (HSTs) causing Alternaria blotch on apple, a worldwide distributed disease (Probable). AM-toxins are cyclic depsipeptides containing the 3 residues 2-hydroxy-isovaleric acid (2-HIV), dehydroalanine, L-alanine which are common for all 3 AM-toxins I to III. The fourth precursor is L-alpha-amino-methoxyphenyl-valeric acid (L-Amv) for AM-toxin I, L-alpha-amino-phenyl-valeric acid (L-Apv) for AM-toxin II, and L-alpha-amino-hydroxyphenyl-valeric acid (L-Ahv) for AM-toxin III (Probable). AM-toxins have two target sites for affecting susceptible apple cells; they cause invagination of the plasma membrane and electrolyte loss and chloroplast disorganization (PubMed:22846083). The non-ribosomal peptide synthetase AMT1 contains 4 catalytic modules and is responsible for activation of each residue in AM-toxin (PubMed:10875335). The aldo-keto reductase AMT2 catalyzes the conversion of 2-keto-isovaleric acid (2-KIV) to 2-hydroxy-isovaleric acid (2-HIV), one of the precursor residues incorporated by AMT1 during AM-toxin biosynthesis, by reduction of its ketone to an alcohol (PubMed:15066029). The cytochrome P450 monooxygenase AMT3 and the thioesterase AMT4 are also important for AM-toxin production, but their exact function within the AM-toxin biosynthesis are not known yet (PubMed:17990954). Up to 21 proteins (including AMT1 to AMT4) are predicted to be involved in AM-toxin biosynthesis since their expression is highly up-regulated in AM-toxin-producing cultures (PubMed:17990954).
Family
Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
Species
Alternaria alternata
Sequence
MASYGFPLTASSLVDWTSLTFSPIEVNGHIQCTYSPEVAEWGAPHFVKDPYLRVHGLAPALNYGQQIFEGMKAFRTPTGSIRLFRPKMNAVRFAHSASFVAIPPVPEALFLRAVHLAVGLNSEFVPPYDSRGSALYIRPIAFASSATVNLAPADHFTFCVFVMPVAPLSTGAGQGLRALVVEDVDRAAPKGTGSAKVGGNYAPIVTTMQRAKADGYGLTLHLDSATHTMVDEFSASGFIGVRVDAGKTTMVVPDSPTILRSITVDSMCRIAESFGWQVQRRAVSFTELAELSEAFAVGTAFILTPVRAITRPCTHTCIEYTADYRSSASAYTRLLETLQGIQQGWLDDAWGWTEEVQDPSSDEFITDTVQARR
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service