Catalyzes the isomerization of trans-2-decenoyl-ACP to cis-3-decenoyl-ACP. Most active with 10-carbon enoyl-ACP. Can also use 12-carbon enoyl-ACP as substrate, but not 14- and 16-carbon enoyl-ACP.

Belongs to the enoyl-CoA hydratase/isomerase family.

261 amino acids

MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEENPAVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVLMEVDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAAQLAMTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWESQFKDWQGYATLELNLQKSLAQTEDFKEGVRAHSERRRPKFIGK

28.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make fabM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here