Toxic component of a type IV toxin-antitoxin (TA) system (PubMed:14594833, PubMed:28257056, PubMed:28931012). Acts as a toxin inhibitor that blocks cell division and cell elongation via FtsZ and possibly also MreB (although no interaction with MreB has been proven) (PubMed:28931012). Overexpression results in inhibition of growth in liquid cultures and a decrease in colony formation (PubMed:14594833, PubMed:28257056, PubMed:28931012). These effects are overcome by concomitant expression of cognate antitoxin YafW, which leads to toxin loss by an unknown mechanism (PubMed:14594833, PubMed:28257056). Overexpression leads to formation of lemon-shaped cells and cell lysis; inactivated by overexpression of cognate antitoxin YafW but not when the 2 genes are coexpressed from the same plasmid (PubMed:28257056). Also neutralized by overexpression of non-cognate antitoxins YfjZ and CbeA (PubMed:28257056). Co-overexpression of toxin YkfI and antitoxin YafW leads to formation of elongated cells (PubMed:28257056).

Belongs to the CbtA/YkfI/YpjF toxin family.

113 amino acids

MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGFSWQEQSPYLRAADILRARQATGLLRQSRNNVVR

12.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ykfI using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here