Toxic component of a type II toxin-antitoxin (TA) system. Has RNase activity (By similarity). Is very toxic upon expression in E.coli. Its toxic activity is probably neutralized by the cognate antitoxin RelB3.

Belongs to the RelE toxin family.

88 amino acids

MKVLFAKTFVKDLKHVPGHIRKRIKLIIEECQNSNSLNDLKLDIKKIKGYHNYYRIRVGNYRIGIEVNGDTIIFRRVLHRKSIYDYFP

10.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make relE3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here