Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity.

Belongs to the TolB family.

442 amino acids

MRHRSCFSLFAGLALVFCLAVGTAAAGPVQVDIYGPGQGSLNLAMAAPLGPTPGTPVSGMGVKLNGFINENLSFLPFLRLVDQRAILGGTVMQGYKSPDIDLKRFQLAGADLVVTAGWPQGDASGSFVELRVYEALSGKLVFGKAYSHVEDGLLPNVADRFCSDLMKALTGRGEFFKSTLAFVKHDGKNKRDVWLVKPVGRDLRKITNLPGEALSPSWSPDGRFVVFSHFDDRSHALGVWDRLTRQVQRIRFPGNTVIGPCFLPDNKVAVSLSSGRNPDIFLLNHLFKKERELEANPSINVSPSFDATGTKMAFTSSRMGGPQVFMKDMTTGQVTRISKTGSYNTEPSISPDGTLVAFTKMTDTGHRIFVYDMVTQSERQVSFGPGRDEQPSFAPDSYFLAFTSNRNGAQQIFLVTRHGGDPKRVPTGPGDASFARWGMIPE

48.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make tolB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here