Description
Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. TolB occupies a key intermediary position in the Tol-Pal system because it communicates directly with both membrane-embedded components, Pal in the outer membrane and TolA in the inner membrane.
Family
Belongs to the TolB family.
Sequence
MKQALRVAFGFLMLWAAVLHAEVRIEITQGVDSARPIGVVPFKWAGPGAAPEDIGGIVAADLRNSGKFNPLDRSRLPQQPATAQEVQPTAWSALGIDAVIVGLVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGTKLAFALSKTGSLNLYVMDLASGQIRQITDGRSNNTEPTWFPDSQTLAFTSDQAGRPQVYKMNINGGAAQRITWEGSQNQDADVSSDGKFMVMVSSNNGQQHIAKQDLVTGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKSPAWSPYL
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service