About Products Protein Database Contact

Protein expression services for tolB | Tol-Pal system protein TolB

Description
Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity. TolB occupies a key intermediary position in the Tol-Pal system because it communicates directly with both membrane-embedded components, Pal in the outer membrane and TolA in the inner membrane.
Family
Belongs to the TolB family.
Species
Salmonella gallinarum (strain 287/91 / NCTC 13346)
Length
430 amino acids
Sequence
MKQALRVAFGFLMLWAAVLHAEVRIEITQGVDSARPIGVVPFKWAGPGAAPEDIGGIVAADLRNSGKFNPLDRSRLPQQPATAQEVQPTAWSALGIDAVVVGQVTPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGTKLAFALSKTGSLNLYVMDLASGQIRQITDGRSNNTEPTWFPDSQTLAFTSDQAGRPQVYKMNINGGAAQRITWEGSQNQDADVSSDGKFMVMVSSNNGQQHIAKQDLVTGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKSPAWSPYL
Mass
46.1 kDa
Simulated SDS-PAGE
Western blot of tolB recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make tolB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here