Necessary for the efficient intracellular multiplication of tobamoviruses, probably being a membrane anchor promoting the formation of the replication complex.

Belongs to the plant tobamovirus multiplication TOM1 protein family.

291 amino acids

MTDSGLMMPAEIAGILTTAITSWWDDVNESTQWQDGIFFALCGAYALVSAVALVQLIRIQMRVPEYGWTTQKVFHLMNFVVNGVRAVLFGFHMQVFLVHPKALCWVLLDLPGLLFFSAYTLLVLFWAEIYHQARSLPTDKLRITYISVNVAVYLAQIGIWAYIWVHDNSTVELVGKIFIAVVSFIAALGFLLYGGRLFFMLRRFPIESKGRRKKLHEVGSVTAICFTCFLIRCVVVAVSAFDKDLTLDVLDHPVLNLIYYMVVEVLPSALVLFILRKLPPKRVSAQYHPIQ

33 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TOM1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here