Component of the transcription complexes of the pulmonary surfactant-associated protein-B (SFTPB) and -C (SFTPC). Enhances homeobox protein Nkx-2.1-activated SFTPB and SFTPC promoter activities (By similarity).

Belongs to the TAP26 family.

241 amino acids

MAPVWPAARGRTGGLGTRGRVSPVEFRNKNVKRKTWRPNHLQAFAGSVREGQGFAFRRKLKIQQTYKKLLRREKKSQTPSESPFTDWYPDHLKHLYLAEEERLKKQLRKADQPLSEEQVDQPLPEDQGSSDQALSEERCSIEQPQPAEPCSIRINSINIPKKNKKKTSNQKAQEEYEQIQAKRAAKKQEFERRKQEREEAQRLYKKKKMEVFKILSKKTKKGQPNLNLQMEYLLKKIQENN

28.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CCDC59 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here