About Products Protein Database Contact

Protein expression services for thyA | Thymidylate synthase

Description
Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis.
Family
Belongs to the thymidylate synthase family. Bacterial-type ThyA subfamily.
Species
Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Length
264 amino acids
Sequence
MKQYLELLNRVLTEGVRKEDRTGTGTISVFGHQMRFNLEEGFPLLTTKKLHLKSIIYELLWFLNGDTNVKYLQDHGVRIWNEWADADGSLGHIYGYQWRSWPDYKGGSIDQITEAVETIKHNPDSRRIIVSAWNVADLDNMNLPPCHAFFQFYVANGRLSLQLYQRSADIFLGVPFNIASYALLLQMMAQATGLKAGDFVHTLGDAHIYSNHLEQVKLQLTREPRALPRMEINPDVKSIFDFKFEDFNLTGYDPHPHIKGEVAV
Mass
30.3 kDa
Simulated SDS-PAGE
Western blot of thyA recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make thyA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here