Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis.

Belongs to the thymidylate synthase family. Bacterial-type ThyA subfamily.

269 amino acids

MQAYLDLIDKILREGVRKPDRTGTGTLSIFGYQMRFDLGAGFPLVTTKKLHWKSIVHELIWFLRGDTNIGYLKDNGVGIWDEWADDSGDLGPVYGRQWRSWQAPDGRTIDQIANVIDEIQRDPFSRRLLVSAWNPADLPAMALAPCHCLFQFNVRDDSTGTRRLDLQLYQRSGDAFLGAPFNIASYALLTELVASVCGLTPGDFVHTFGDAHLYLNHIDQAKLQLSRDPRPLPRLRINGNVKSLFDIRFEDLSLENYDPHPVIKAPVAV

30.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make thyA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here