Poxvirus TMP kinase is able to phosphorylate dTMP, dUMP and also dGMP from any purine and pyrimidine nucleoside triphosphate. The large substrate specificity is explained by the presence of a canal connecting the edge of the dimer interface to the TMP base binding pocket, canal not found in the human homolog (By similarity).

Belongs to the thymidylate kinase family.

205 amino acids

MSRGALIVFEGLDKSGKTTQCMNIMESIPTNTIKYLNFPQRSTVTGKMIDDYLTRKKTYNDHIVNLLFCANRWEFASFIQEQLEQGITLIVDRYAFSGVAYATAKGASMTLSKSYESGLPKPDLVIFLESGSKEINRNVGEEIYEDVAFQQKVLQEYKKMIEEGEDIHWQIISSEFEEDVKKELIKNIVIEAIHTVTGPVGQLWM

23.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TMK using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here