The enzymes which catalyze the reversible phosphorolysis of pyrimidine nucleosides are involved in the degradation of these compounds and in their utilization as carbon and energy sources, or in the rescue of pyrimidine bases for nucleotide synthesis.

Belongs to the thymidine/pyrimidine-nucleoside phosphorylase family.

438 amino acids

MFLPQEFIRQKRNRQALDRDGIAAFVRGVTDGSVTEGQVAAFAMAVYFNDLSTDERVALTLAQRDSGDVLDWHALELDGPVIDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLSAIPGYNVTPDTDAFRRAVRDVGVAIIGQTARLAPADMRIYAIRDVTATVESVAMITASILSKKLAAGLDGLVMDVKVGSGAFMPTAEQSAELARSIVDVGNGAGMKTTAILTDMNQSLAPCAGNALEVACAIDYLTGKSRPARLHDVTMALSAELLVTGGLAHDVADARAKLLRALDSGAAAERFARMVTALGGPADLIDAPARHLARAKVVVPVPARASGVVQRVDCRALGLAVVALGGGRTRAADAIDYSVGLTALAEIGQRVEADQPLGYVHARDAAAAAHAVDTIQRSYVLGEAGDAPPTIYQQIG

45.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make deoA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here