Phosphorylates thymidine. ASFV replicates in the cytoplasm of infected cells and contains genes encoding a number of enzymes needed for DNA synthesis, including thymidine kinase. Important for growth in swine macrophages in vitro and is a virus virulence factor in swine.

Belongs to the thymidine kinase family.

188 amino acids

MNIIRKLKPGTISLVLGPMFAGKTTFLIHCIYMLERLEKKVVFIKSTKNTRDKTIKTHSGIQLQSKQCEIIESTQLSDVGSLTDIHAVVIDEAHFFDDLIKCRAWADEEKIIILAGLNASFEQKMFQPIVHIFPYCSWIKYIGRTCMKCNRHNACFNVRKNADKTLILAGGSELYVTCCNNCLKKQMY

21.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Mal-058 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here