About Products Protein Database Contact

Protein expression services for txn | Thioredoxin

Description
Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions (By similarity). Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity (By similarity).
Family
Belongs to the thioredoxin family.
Species
Ictalurus punctatus
Length
107 amino acids
Sequence
MVVHIENLNAFSAALKNAGDKLVVVDFTATWCGPCQKIGPIFETLSKSEDYQNVVFLKVDVDDAADVSSHCDIKCMPTFHFYKNGQKIDEFSGANEQTLKQKINDHK
Mass
12 kDa
Simulated SDS-PAGE
Western blot of txn recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make txn using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here