Thiol-disulfide oxidoreductase probably involved in the redox regulation of chloroplastic enzymes. Required for chloroplast biogenesis and differentiation. Functions as an electron donor for plastidial 2-Cys peroxiredoxins and participates in hydrogen peroxide scavenging system in chloroplasts. Possesses reducing activity towards insulin disulfide bonds.

Belongs to the thioredoxin family. Plant M-type subfamily.

172 amino acids

MALETCFRAWATLHAPQPPSSGGSRDRLLLSGAGSSQSKPRLSVASPSPLRPASRFACQCSNVVDEVVVADEKNWDSMVLGSEAPVLVEFWAPWCGPCRMIAPVIDELAKEYVGKIKCCKVNTDDSPNIATNYGIRSIPTVLMFKNGEKKESVIGAVPKTTLATIIDKYVSS

18.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TRXM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here