Required to facilitate the formation of correct disulfide bonds in some periplasmic proteins and for the assembly of the periplasmic c-type cytochromes. Acts by transferring electrons from cytoplasmic thioredoxin to the periplasm. This transfer involves a cascade of disulfide bond formation and reduction steps (By similarity).

Belongs to the thioredoxin family. DsbD subfamily.

600 amino acids

MRTLILCFSLLFALLTQPAWAIFGNNAGNNTGTASFAPTQNRFVPVDEAFPFNAFQQGSTLFIDWQVKEGYYLYQDRISISGENLEIGEYSLTEGEPYHDEFFGDVKIYTTPLSVPLPLVAYQSGAKVIVQYQGCAKAGFCYPPETRVIDITPFNAESNRVIEPKTNTSTQTTLPQTDNAPTSAQDSLANKLAQNWWTPLLFLALGVGLAFTPCVLPMYPILTSIVLGGAQLTQRRALLLSVIYVQGMALTYTLLGLVVASAGLQFQAALQHPYVLMGLSVLFVALALSMFGLYSLQLPSGVQTWLNSLSNAQQGGSLPGVFAMGAISGLVCSPCTTAPLSGALLYVAQSGDLLTGAVALYALAIGMGIPLILVAVFGNKLLPKAGNWMERVKTLFGFVLLAAPIFLLERIVPEFWSSVLWSALGLAAFGWLYHVKNSLPFGGWKQSLIGIVAILGLLASAQPLLNHWLAPTQTAQQVKQIQFTRIANLSELQSALAEAKAQGKSVMLDFYADWCVACKEFEKYTFHAKQVENKLSGFVLLQADVTKNQPQDIELLKALNVLGLPTIEFWNAQGEPVPNARITGFMAEQPFLDHLTQQGL

65.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dsbD using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here