Required for disulfide bond formation in some periplasmic proteins. Acts by transferring its disulfide bond to other proteins and is reduced in the process. DsbC is reoxidized by a yet uncharacterized protein. Also acts as a disulfide isomerase.

Belongs to the thioredoxin family. DsbC subfamily.

237 amino acids

MKKRFMMFTLLAAVFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK

25.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make dsbC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here