Probably a thiamine precursor-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins.

166 amino acids

MKLMDNKNIKKLTLLAIWTALTFVLGRLFTFPIPGSAGNILTLLDVGIYTAVFLFGKREAAIIGGFAAFLLDLTAGFSNYMFFSLIIHGGQGYLAGLTRYKWLNFLLSLLVMVGGYFIVGGLMYGWGSAIAGLWVNIVQVIVGFVLAKVLSPLIERTGILNGFRKA

18.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make hmpT using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here