BTD-4 has antimicrobial activity against the Gram-negative bacterium E.coli ML35, the Gram-positive bacterium S.aureus 502a, and the fungus C.albicans 16820.

Belongs to the alpha-defensin family. Theta subfamily.

76 amino acids

MRTFAFLTAMLLLVALHAQAEARQARADEAAIQEQPGADDQGMAHSFTRNESAVLPLSESERGLRCICLLGICRLL

8.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BTDC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here