Description
Adapter protein involved in p53/TP53 response that acts by regulating and mediating the assembly of multi-protein complexes. Required to facilitate the interaction between JMY and p300/EP300 and increase p53/TP53-dependent transcription and apoptosis. Prevents p53/TP53 degradation by MDM2 (By similarity).
Sequence
MMADEEEEAKQVLQKLQELVDQLYCFRDSYFETHSVEDAGQKQQDVQEEMEKTLRQMEEVLGSVQVEAQALMLKGKALNVTPDYSPEAEVLLSKAVKLEPELVEAWNQLGEVYWKKGDVAAAHTCFSGALTHCKNKVSLQNLSMVLRQLQTDSGDEHSRHVMDSVRQAKLAVQMDVLDGRSWYILGNAYLSLYFNTGQNPKISQQALSAYAQAEKVDRKASSNPDLHLNRATLHKYEESYGEALEGFSQAATLDPAWPEPQQREQQLLEFLSRLTNLLASKGKTKPKKLQSMLGNLRPAHLGPCGDGRYQSATGQKVTLQLKPLSTLQPGVNSGTVVLGKVVFSLTTEEKVPFTFGLVDSDGPCYAVMVYNVVQSWGVLIGDSVAIPEPNLRHHQIQHKGKDYSFSSVRVETPLLLVVNGKPQNSSSQASATVASRPQCE
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service