Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip (By similarity). Required for polyglutamylation of axonemal tubulin, which is a prerequisite for correct assembly of cilia and for normal cilia beat amplitude. Does not seem to be required for neuronal microtubule polyglutamylation.

Belongs to the TTC30/dfy-1/fleer family.

651 amino acids

MPPMTIKDGEYTATVYKMIKEGRYGDAIHILSKEHQKHTKSRAALSLLGYCYYHMQDFTNAAECYEQLTQLHPEVEDYKLYYAQSLYGACAFPEAMKSTFLLDNTTSHTKMIKLQAAIKYGEEDYSGAKTLVEQLPQEDPDYDVDLGCLLYKEGEFEEACKKFMSSMNVLGYQPDLAYNIALCYYSLKQYASALKYIAEIIERGIREHPELSIGMTTEGIDVRSVGNTLILHETALIEAFNLKAAIEYQLKNYAAAQEALTDMPPRSEEELDPVTLHNQALMNMDTKPTEGFEKLAFLLQQNPFPPVTFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYEFLDAMITCQTAPEEAFRKFDENAGKLTEQLRKVTKQVQEARHNRDDESLKKYVQDYDEVLEKYIPVLMAQAKIYWNRENYSMVEKIFHKSLEFCNEHDTWKLNVAHVLFMQDNKYKEAIGFYEPIVKKHYENILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQISYDDPDKKIFHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWFYAKRCFLSLLENMAKHMIMLRDSVVQECIQFLEHCELYGKDVLAIIEQPLEEDRMHIGKNTVTYESRLIKALFYEVTGWNE

75.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ttc30a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here