Involved in basal (BT) and acquired thermotolerance (AT), probably by preventing plasma membrane lipids peroxidation induced by severe heat-shock (HS) (PubMed:19302169, PubMed:23837879). Lipocalin that confers protection against oxidative stress caused by heat, freezing, paraquat and light (PubMed:18671872, PubMed:19302169). Confers resistance to high salt (NaCl) levels, probably by protecting chloroplasts from ion toxicity via ion homeostasis maintenance (PubMed:20959419, PubMed:24028869). Required for seed longevity by insuring polyunsaturated lipids integrity (PubMed:23837879).

Belongs to the calycin superfamily. Lipocalin family.

186 amino acids

MTEKKEMEVVKGLNVERYMGRWYEIASFPSRFQPKNGVDTRATYTLNPDGTIHVLNETWSNGKRGFIEGSAYKADPKSDEAKLKVKFYVPPFLPIIPVTGDYWVLYIDPDYQHALIGQPSRSYLWILSRTAQMEEETYKQLVEKAVEEGYDISKLHKTPQSDTPPESNTAPEDSKGVWWFKSLFGK

21.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TIL using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here