Late DNA-binding protein which binds to the hairpin form of the viral telomeric sequence. Required for the production of mature virions (MV) (By similarity).

Belongs to the chordopoxvirinae I1 family.

312 amino acids

MAEFEDQLVFNSISARALKAYFTAKINEMVDELVTRKCPQKKKSQAKKPEVRIPVDLVKSSFVKKFGLCNYGGILISLINSLVENNFFTKDGKLDDTGKKELVLTDVEKRILNTIDKSSPLYIDISDVKVLAARLKRSATQFNFNGHTYHLENDKIEDLINQLVKDESIQLDEKSSIKDSMYVIPDELIDVLKTRLFRSPQVKDNIISRTRLYDYFTRVTKRDESSIYVILKDPRIASILSLETVKMGAFMYTKHSMLTNAISSRVDRYSKKFQESFYEDIAEFVKENERVNVSRVVECLTVPNITISSNAE

35.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make TI1L using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here