About Products Protein Database Contact

Protein expression services for CD3D | T-cell surface glycoprotein CD3 delta chain

Description
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3D plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells.
Species
Sus scrofa
Length
171 amino acids
Sequence
MEHSRFLSGLILAAFLSRVSPYEVEMEELEDKVFVSCNTSIIWLQGTEGELLSDKKIDLGKRILDPRGLYKCNAPKEQDSNSKIFLQVYYRMCQNCVELDSATLAGIIVTDIIATLLLALGVYCFAGHEMGRFSRAADTQDLLRNDQLYQPLRDRNDGQYSRLGENWARNK
Mass
19.5 kDa
Simulated SDS-PAGE
Western blot of CD3D recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make CD3D using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here